SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y54G11A.10a from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y54G11A.10a
Domain Number 1 Region: 87-180
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-27
Family PDZ domain 0.0081
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 2.53e-22
Family L27 domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y54G11A.10a   Protein: CE43589   Gene: WBGene00002996
Sequence length 209
Comment CE43589 WBGene00002996 locus:lin-7 PDZ domain (Also known as DHR or GLGF). status:Confirmed UniProt:A5PEX5 protein_id:CAN99708.2
Sequence
MDNPDGPNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESI
DADTTPEIKAAATAKATVAAFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISR
IIPGGVADRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLKSAVGSVKLVIRYMPKLLDEM
ERRFERQRIRSTQQSPTLPTPSSSTNPRR
Download sequence
Identical sequences A5PEX5
Y54G11A.10a Y54G11A.10a Y54G11A.10a NP_001122664.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]