SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y54G11A.10b from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y54G11A.10b
Domain Number 1 Region: 87-179
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-23
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 2.47e-22
Family L27 domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: Y54G11A.10b   Protein: CE43616   Gene: WBGene00002996
Sequence length 208
Comment CE43616 WBGene00002996 locus:lin-7 PDZ domain (Also known as DHR or GLGF). status:Confirmed UniProt:Q9U245 protein_id:CAA22459.3
Sequence
MDNPDGPNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESI
DADTTPEIKAAATAKATVAAFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISR
IIPGGVADRHGGLKRGDQLIAVNGNVEAECHEKAVDLLKSAVGSVKLVIRYMPKLLDEME
RRFERQRIRSTQQSPTLPTPSSSTNPRR
Download sequence
Identical sequences Q9U245
Y54G11A.10b Y54G11A.10b NP_496982.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]