SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZC395.7 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZC395.7
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily ITPase-like 1.31e-59
Family ITPase (Ham1) 0.000000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZC395.7   Protein: CE25662   Gene: WBGene00001823
Sequence length 184
Comment CE25662 WBGene00001823 locus:hap-1 status:Confirmed UniProt:Q9GYG4 protein_id:AAG00041.1
Sequence
MSLRKINFVTGNVKKLEEVKAILKNFEVSNVDVDLDEFQGEPEFIAERKCREAVEAVKGP
VLVEDTSLCFNAMGGLPGPYIKWFLKNLKPEGLHNMLAGFSDKTAYAQCIFAYTEGLGKP
IHVFAGKCPGQIVAPRGDTAFGWDPCFQPDGFKETFGEMDKDVKNEISHRAKALELLKEY
FQNN
Download sequence
Identical sequences Q9GYG4
ZC395.7 CE25662___KOG3222 6239.ZC395.7 ZC395.7 ZC395.7 WR86 ZC395.7 NP_498121.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]