SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 181.m08706 from Cryptococcus neoformans JEC21

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  181.m08706
Domain Number - Region: 307-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00044
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 181.m08706
Sequence length 604
Comment |CNA01410||hypothetical protein|Cryptococcus neoformans|chr_1|chr1|181
Sequence
MKKSVELSESESGIVRGGKRDEERHILARLEFASALHDAPAPPPAAPSHALHRRQGVLSL
RGRKAAARSPQKDTPVRPHTLQHPRTTARRRPARGKKVEETLPVRYPCSPPGGQAGSEAQ
DRQRKTRKGARGMEGAKAEGAGGDERDGRGKQAVEHHQVKKRFEAYRSVLRFPSLQITQD
TTPTCNQMPPDPPWRTPLGRTFFHLPSPVGEYTQHESNKAEGESAKGSSYTDILKRTFKD
FSDVSVGSDVEIVHLHRQYPPKASAAAEEELEEGELEQDDWTVDIEPMRGYVEDDSNSII
FDDDDDGEPPNEPADLPSFHGECWNCLQQGHSLTHCPYPRNHLQINHSRELFFYARDNLP
PPRTERYLHDYLNMRVTVQEKERRLELLGKFRPGKIGKELDHAARMLVDDSDSGEMLVDE
IQWDKREYEWIQNIAKWGYPPGWTTALNPIEFLKDRISSLEAYDTAYRLTPEPGEELVIF
GADDDEDDEGSSMRDVTLGNADEREKSKEEGDDGSEMSIVSDSPSPSSLPLSPASSRSPP
TPSDIPPPPSPPPDLPPPPPPPPCDLPPPPPPNRWADYHTDMFASSRLVVYDETRPFVLG
TYAR
Download sequence
Identical sequences XP_567090.1.95466 181.m08706 214684.CNA01410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]