SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 186.m03828 from Cryptococcus neoformans JEC21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  186.m03828
Domain Number 1 Region: 5-288
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.02e-77
Family Capz beta-1 subunit 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 186.m03828
Sequence length 293
Comment |CNB03880||f-actin capping protein beta subunit, putative|Cryptococcus neoformans|chr_2|chr2|186
Sequence
MADPDQTFDALLDLLRRLPPTRVEENVNALCDLAPEYADDLLGNVDQPLKVLVDEEKARE
FLGCDYNRDGDSFRSPWTNNYLPEPVPGPTPSPRLRELEIQLNAAFDTYREMYFEGGVSS
VYLWDLDDEPQGKEMNFAGVVLVKKTLQSQSGVPTAPAGSWDSLHVFECHERGRSAKYKL
TSTVMLVLETATLAKAENKGPEDSDGKGGVTLSGSMTRQAEIDYPLTTPQGHISNIGRIV
EDMEIKMRNLLSAVYFGKTKDVINDLRSQSGLEAKSKEDLLRAELAGKLGGRK
Download sequence
Identical sequences Q5KLV9
214684.CNB03880 XP_569217.1.95466 186.m03828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]