SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21672881|ref|NP_660946.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21672881|ref|NP_660946.1|
Domain Number 1 Region: 178-563
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.75e-93
Family beta-Lactamase/D-ala carboxypeptidase 0.00011
Further Details:      
 
Domain Number 2 Region: 63-226
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.62e-41
Family Penicillin binding protein dimerisation domain 0.00068
Further Details:      
 
Domain Number 3 Region: 589-644
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000589
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21672881|ref|NP_660946.1|
Sequence length 651
Comment penicillin-binding protein 3 [Chlorobium tepidum TLS]
Sequence
MNQARTTPENHRGTSDHEFSLRLGIMVALMLLFCLAIVSKLLGIQVFDVKKYRAKASRQY
ETIVTEKARRGRILDRYGRPLAESVESISFYADPEQVNDAGATAKLFANTFGKSRDYYLD
LLRKNKRFVWLERNVPVSQAAKLMSLKIKGVGFRREQHRYYLNVAAQLIGLTDRDNKGIS
GLEKSFESQLSGRDGVRIFQRSATGERYPAPDADQVQPLAGNDVTLTIDADVQGILEEEI
AQAVKEFKASGAMGIIMDVRTGEIIAMANYPTFDLNRRSGLTADQMRNRAVTDMFEPGST
FKIVMASAATEALGWRAETPVDGHGGSITIYGKQVRDHEPFGAMNFQKAITESSNVVAAS
TAMRVGATTFYRYAHALGFGQKTGVGLIGESGGFLKPVSRWGKMTLPWMGYGYQVMATPL
QVLQAYATLANDGVRMRPFIIKRVSGPDGKTIEETRPLKVVQALKPETAHYMAREYFRAV
VEKGTGMSAKIEGIPVAGKTGTAQKLHNGSYQGWRYYVASFVGFFPYDNPQYAAIIVVDE
PQTAYYASAVAAPVFSRVCGRAVACSLEMQKRLSMKSPEKELLDRVSTVVVPELKGLRES
EAAKLLEWNGLKLEPSGSSGGSVTSQSIAPGTKVQKETTVRVRLAKRVQNK
Download sequence
Identical sequences Q8KGC8
NP_660946.1.51846 gi|21672881|ref|NP_660946.1| 194439.CT0040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]