SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21673625|ref|NP_661690.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21673625|ref|NP_661690.1|
Domain Number 1 Region: 11-195
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.33e-31
Family Clp protease, ClpP subunit 0.017
Further Details:      
 
Domain Number 2 Region: 365-432
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000131
Family NfeD domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21673625|ref|NP_661690.1|
Sequence length 437
Comment NfeD protein [Chlorobium tepidum TLS]
Sequence
MVKRLLKFCVIPAIAVFLLVAMPVAGQAAQIRAMSLTGSVNAGSAAYFLRVLDEANRDND
TLLLVELDTPGGLVSSLRQMVQGVMASRVPVVVYVAPSGAQAASAGALLLLSANVAAMAP
GTETGAAHPVDISGGGEKGSVMGKKIENDLAAFARSLAQKRGRSPEWAERAVRESIASTA
SEALAAGVIDTVADNRKELLVSIDGRKVETAIGELIIRTTNVPVKEASPTFGEEVMMAIA
DPNIAYFLLLLGLAGLWFELSTPGAVLPGVAGAIALVLGAWAMQLLPVNVTGLLLILLAI
LFFGLEIFVVSSGALAIAGLVALFIGSVMVFNQPELGLVINWWVFLPLFLSFSAGVLLLV
FVVFRSTRRKAISGREGLVGETGTVERAIGEGKDGKVFVHGELWDASANGLIPAGSQVTV
TGIEGMRLMVKQNSKEE
Download sequence
Identical sequences Q8KE94
194439.CT0795 NP_661690.1.51846 gi|21673625|ref|NP_661690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]