SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21674030|ref|NP_662095.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21674030|ref|NP_662095.1|
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 101-164
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000772
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|21674030|ref|NP_662095.1|
Domain Number - Region: 179-238
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0249
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21674030|ref|NP_662095.1|
Sequence length 245
Comment hypothetical protein CT1205 [Chlorobium tepidum TLS]
Sequence
MKKVLIFLLFLLIIAIVAVDSFLLPYYTESGSQTTVPNVTNMTYDAAKRELRRVGLNAMK
SYNVRYLPDVPPDRVIDQVPEPGSIVKPGRSIILVLNRLDKPSYPVPDLVGRTEAEARTE
LERLGMVVAEVQTQVVSDADQDGRVLSQSIPPDVVLKSGSQVSFIVGKLEQEPTGMRLVI
VPDVLGMSVDQARSVIVKDGLLLGKISYENSDLLVPGTVVSQKPSANAMVQFGRPVDITV
VGNPN
Download sequence
Identical sequences 194439.CT1205 gi|21674030|ref|NP_662095.1| NP_662095.1.51846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]