SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21674245|ref|NP_662310.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21674245|ref|NP_662310.1|
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-59
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 154-301
Classification Level Classification E-value
Superfamily Translation proteins 6.85e-28
Family Elongation factors 0.0071
Further Details:      
 
Domain Number 3 Region: 400-514
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.8e-27
Family EF-G/eEF-2 domains III and V 0.0074
Further Details:      
 
Domain Number 4 Region: 305-389
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000719
Family EF-G/eEF-2 domains III and V 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21674245|ref|NP_662310.1|
Sequence length 609
Comment GTP-binding elongation factor family protein, TypA subfamily [Chlorobium tepidum TLS]
Sequence
MSRKQNIRNIAIIAHVDHGKTTLVDSIFKQTGAFRENQHVDVRVMDSNPQERERGITIFS
KNAAVQHKGCKINIVDTPGHADFGGEVERILKMVDGVLLLVDAFEGPMPQTKFVLRKALE
LHLKPIVVINKIDRPQADPEKVHDQVLDLFIALGADEDQLDFPYIFASAKNGIAKCNMSD
PDGDMSLLLDMIVKEIPAPEADDDAGFQMLVTSLDYSDYIGKIAIGRIQRGKVAPGNQLT
LVTQDGVVGKGTVTKLFLFDRTQRVEAMEATAGDIVALAGIAAANVGETLTTPDQPEPIE
SFEISKPTLSMLFSVNDSPFAGQEGKEVTSRKIRERLMKEIMTNVALNVEETDSADTFRV
SGRGELHLSVLIETMRREGYELAISRPEVILREENGVTMEPVEHVTIDVPEEYTGVVIEK
MGRRKAEMTNMSTLRGGMNRLEFEIPTRGLIGYNLEFTTDTKGEGMMSHVFHNYQPYKGK
LPSRETGALVSAETGVAVAYAISSLEDRGTFFIGPNAKVYEGMVVGESTRDLDITVNICK
TKKLTNMRASGSDDSIRLTPPKRLSLEQALEFINDDELLEVTPENIRIRKKILNADLRAK
ATKKAKAMA
Download sequence
Identical sequences Q8KCJ5
CtR162 NP_662310.1.51846 194439.CT1424 gi|21674245|ref|NP_662310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]