SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21674272|ref|NP_662337.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21674272|ref|NP_662337.1|
Domain Number 1 Region: 9-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-57
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 407-502
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.8e-22
Family EF-G/eEF-2 domains III and V 0.024
Further Details:      
 
Domain Number 3 Region: 300-378
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.04e-19
Family EF-G/eEF-2 domains III and V 0.0044
Further Details:      
 
Domain Number 4 Region: 210-286
Classification Level Classification E-value
Superfamily Translation proteins 0.000012
Family Elongation factors 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21674272|ref|NP_662337.1|
Sequence length 605
Comment GTP-binding protein LepA [Chlorobium tepidum TLS]
Sequence
MPPTGTEVGMIRNFCIIAHIDHGKSTLADRLLEVTHTLERNQMSTAQVLDDMDLERERGI
TIKSHAVQMRYTAKDGQDYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQT
IANLYLAIEAGLEIIPVINKIDLPSSDVEGVARQIIDLIGVNRDEILRVSAKNGIGVDDL
MEAIVARVPAPADNRQMPLRALIFDSVFDAYRGAIAYIRIVDGVLKKGDRVRFFANDKIF
MADEIGTMSLKRNPVDILEAGNVGYLICSIKDVKDAKVGDTVTLVENPAAERLAGYKDVK
PMVFSGLYPVESNEFEDLRESLEKLSLNDASLVYTPETSAALGFGFRCGFLGLLHMEIIQ
ERLEREYGVNIITTVPNVEYRVIMTSGETVEVDNPSKMPETTKINWIEEPYVSMQIITMS
EYIGNIMKLGMERRGEYKNTDYLDTSRVNIHFEFPLGEVVFDFHDKLKSISKGYASMDYE
YIGYRRSDLVKLDVLLNGEPVDALSSIVHRSKSYEWGRKLCQKLKGIIPRQMYEVAIQAA
IGSRVIARESISAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGRVEVPQEAFLAV
LNIDE
Download sequence
Identical sequences Q8KCH0
gi|21674272|ref|NP_662337.1| NP_662337.1.51846 194439.CT1451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]