SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21674548|ref|NP_662613.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21674548|ref|NP_662613.1|
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000495
Family N-acetyl transferase, NAT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21674548|ref|NP_662613.1|
Sequence length 267
Comment hypothetical protein CT1733 [Chlorobium tepidum TLS]
Sequence
MLGFKDIPLTKKVIHIINDIERPFMIRWSNSHDVQQIHDWLQEEEALEVHGNFLCNWNLT
RQCHEEGRLLVLIDEIKGIPVAYQWGQLLSSGILQVRNGWRGNGLGRLVVEHCVELALQQ
DEMVLQVECKPSSSIPFWEAMGFTIVEGEFGKNAKGFRVLSKNLALPPGGRPILATISSF
PEERNWQDNVPAIASYHLNAIVADDGKVYLAERASFPKCFRRMSRDPVIEIIVEGKLVYR
DKAKYQGAQDHGVKWCRNGFYIDVVTI
Download sequence
Identical sequences Q8KBQ2
370025 APC60287 194439.CT1733 NP_662613.1.51846 gi|21674548|ref|NP_662613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]