SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21675001|ref|NP_663066.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21675001|ref|NP_663066.1|
Domain Number 1 Region: 7-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-106
Family G proteins 0.0000000228
Further Details:      
 
Domain Number 2 Region: 486-606
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-46
Family Translational machinery components 0.000008
Further Details:      
 
Domain Number 3 Region: 272-409
Classification Level Classification E-value
Superfamily Translation proteins 3.3e-35
Family Elongation factors 0.0000781
Further Details:      
 
Domain Number 4 Region: 610-696
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.49e-29
Family EF-G/eEF-2 domains III and V 0.00011
Further Details:      
 
Domain Number 5 Region: 411-488
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.08e-24
Family EF-G/eEF-2 domains III and V 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21675001|ref|NP_663066.1|
Sequence length 704
Comment elongation factor G [Chlorobium tepidum TLS]
Sequence
MARQVALDRVRNIGIMAHIDAGKTTTTERILYYTGRLHKMGEVHEGGATMDWMEQEKERG
ITITSAATTCFWTPKYGNYAGLNHRINIIDTPGHVDFTVEVERSLRVLDGAVALFCAVGG
VEPQSETVWRQANKYGVPRIAYVNKMDRVGANFFETVKAIRERLGANPVPIQIPIGQGEV
FAGFVDLIRMKGIIYDKEDGSTYTEVEIPHDLENEARTWRINMLEAVSELDETLLEKYLN
GEDITEEEIRTVLRQATLGVTIVPVLCGSSFKNKGVQFMLDAVIDYLASPVDDGEVEGHD
PKTEEPIVRQPKDEEPFAALAFKIATDPFVGKLTFFRVYSGVLNAGSYVLNSTTGKKERV
GRVLQMHSNKREERDAVYAGDIAAAVGLKDVRTGDTLCDESKPIVLEKMVFPEPVIEIAV
EPKTKADNDKLGMSLAKLAEEDPTFRVKTDEETGQTLIAGMGELHLEILVDRLKREFKVE
ANVGQPQVAYRETIRGTVEYEGKFVRQSGGKGQFGLVVLRVEPLEEGKGYEFVDEIKGGV
IPKEYIPAVNAGIQEAMKDGVVAGFPMQDIKVTLIDGKYHEVDSSEMAFKIAGSIGFKGA
AKKANPVLLEPIMKVEVITPEEYLGDVMGDLSGRRGHIEGMGQRAGAQFVSAKVPLSQMF
GYSTDLRSMTQGRANYSMEFESYREVPRNIAEALQEKRVGKDSE
Download sequence
Identical sequences Q8KAG9
194439.CT2192 gi|21675001|ref|NP_663066.1| NP_663066.1.51846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]