SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21673544|ref|NP_661609.1| from Chlorobium tepidum TLS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21673544|ref|NP_661609.1|
Domain Number 1 Region: 476-583
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-18
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21673544|ref|NP_661609.1|
Sequence length 618
Comment sulfate transporter family protein [Chlorobium tepidum TLS]
Sequence
MSPESRTLPGIIRSGDPSICRPPVAGNCRSFTSDHFQQMFKPKLFTVLPELTKEQLGRDI
VSGILVGIVALPLGIAFAIASGVSPEKGLISAVIGGFLISFLGGSRVQIGGPTGAFIVIL
YGIVQQYGLNGLMIATIMAGVILIIMGLSHLGSLIKFIPYPVVVGFTSGIAIIIFSSEVK
DFLGLHMASVPADFIDKWAAYFKALPTASPETILVGAVALLIIVFWPKVSRKIPGPLIAL
IVTTVAVHMLHLQVDTIETRFGDISASIPAPSFPSLDMATIRHLIMPATTIALLGAIEAL
LSAVVADGMIGARHKSNMELVAQGVANIVSPLFGGIPVTGAIARTATNIKNGGRTPIAGI
VHAITLLGIMLVFGSWAKLIPMPTLAAILIVVAWNMSEHHVFRQLLKSPKSDVAVLLTTF
GLTVIFDLTIAIEVGMLLSVILFMKRMASLANVGVITGELKDEEDEADPNAIVNRSIPEG
VDVFEISGPLFFGAASKFKDAMHVVEKAPSIRILRMRKVMSIDATGLNMLKELFNDCRKS
GTTLILSGVHTQPLFAMQQYGLADEIGEENIFGNIDDALDRARSLLGLPVQGRPAGFVAS
VKREKELQAKIESKGSGK
Download sequence
Identical sequences Q8KEH5
NP_661609.1.51846 194439.CT0714 gi|21673544|ref|NP_661609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]