SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298736904|ref|YP_003729434.1| from Helicobacter pylori B8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298736904|ref|YP_003729434.1|
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.8e-70
Family Phosphate binding protein-like 0.00000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298736904|ref|YP_003729434.1|
Sequence length 287
Comment hypothetical protein HPB8_1413 [Helicobacter pylori B8]
Sequence
MISVAHSPDADDIFMYYAIKFGWIDCPIKNKTFHNIALDIETLNQEALKNTYDVSAISFG
LYPKIANDYALLPTATSFGNGYGPKLVKKKGVKLKKDFRVALSGEHTTNALLFKIYYKHA
RIAYMNFLDIEKAVLEEKVHAGVLIHENILDFHNELEVEKELWDVWKELIKVDLPLPLGG
MAIRRSIPLYRAILIKKALIKAVEVALKHQNLLSEMLLERSLIRVNKERLQTYLSLYANE
TSTRLSEIQILAIDKLFELGYQHGFYASLLKTKDCLLTDEYLQYRFS
Download sequence
Identical sequences D7FFL3
gi|298736904|ref|YP_003729434.1| WP_000626283.1.23910 WP_000626283.1.90333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]