SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298737164|ref|YP_003729694.1| from Helicobacter pylori B8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298737164|ref|YP_003729694.1|
Domain Number 1 Region: 10-250
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.79e-49
Family Folylpolyglutamate synthetase 0.00025
Further Details:      
 
Domain Number 2 Region: 268-385
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.81e-20
Family Folylpolyglutamate synthetase, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298737164|ref|YP_003729694.1|
Sequence length 389
Comment folylpolyglutamate synthase [Helicobacter pylori B8]
Sequence
MKNSPRLSAFLETKPKEYHKFDPSRFIQIYKDFKNAFFEIQAKVIHIVGTNGKGSTGRFL
TLLLADQNFKVLHFTSPHVFEFRERFFLNGSIVKESVLENAHQQLQSHAFSSACSYFEYA
TLLAVMLAKDCDYLVLEAGLGGEFDSTNALEKTLSVFTPIDYDHKEFLGDSLESIATTKL
KAMGSLSIIAPQQELVLNIAQKIAKDKHAQLIVVQNEISKGVRDYIERHHLAHFLAMNLE
VALKAFEALLPYNKQEVLKNLKPLNLIGRCELLSPNVLIDVGHNPHSAKALKEEIKRVFN
APIVLIYNCYQDKDAFLVLEILKPVIKKVLILELHNERIIQLEKLKGILETLGLEHALFE
DVKENENYLVYGSFLVANAFYKRYQQKRD
Download sequence
Identical sequences D7FGC3
gi|298737164|ref|YP_003729694.1| WP_000798459.1.23910 WP_000798459.1.90333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]