SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530321789|ref|YP_008408054.1| from Paracoccus aminophilus JCM 7686

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530321789|ref|YP_008408054.1|
Domain Number 1 Region: 8-318
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.05e-61
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000494
Further Details:      
 
Domain Number 2 Region: 422-519
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 2.62e-26
Family D-aminopeptidase, middle and C-terminal domains 0.00025
Further Details:      
 
Domain Number 3 Region: 338-412
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00000000259
Family D-aminopeptidase, middle and C-terminal domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|530321789|ref|YP_008408054.1|
Sequence length 521
Comment D-aminopeptidase [Paracoccus aminophilus JCM 7686]
Sequence
MSNFDLAALQHALDLLPQQFRGPGGVAGVVKDGEIVARRAWGYADLNARREMTAATRLPI
CSISKQMTCALLLDLFGAPEALEADLPALLPHLKGQMPSVAQLCHNQSGLRDYWAQTVLE
GARPEGVFTREDGLALLAKNQSTHFTPGQHYSYSNGNFRLIAELIARASGRDFAELMEER
IFHPAGMMSAKVNPDTAQPLDGVTGYEGNDELGFLPAPHGLYWFGDAGNWAALDDMLAWE
RWIDATREDPESLYNRLSAPVSFADGTPAVYGYGLRRDRFSGLEATGHGGALRGFSSFRL
HIARERLSVYVNFNHESGASRAAWRLVEAALGCKIDPEPQAALGWDGLWMDDEQGLFIRT
TSTPAGVKLNYQHTAQMLTPTSDSRAEFHGITLERGPEGLTMRREDENLSVTGRPVPRLD
FADGTEIAGRYLASESGATLEIASRDGGTYIGCSGMLGTGPMERAYAIAPDLWSMPSRRS
MDASPPGEWTVEITRDAAGKVAGLVISNWLARKNIYHRVAA
Download sequence
Identical sequences S5YZV0
WP_020952221.1.73483 gi|530321789|ref|YP_008408054.1| gi|530321789|ref|YP_008408054.1|NC_022049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]