SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33519692|ref|NP_878524.1| from Candidatus Blochmannia floridanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33519692|ref|NP_878524.1|
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily SIS domain 8.23e-41
Family mono-SIS domain 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33519692|ref|NP_878524.1|
Sequence length 193
Comment phosphoheptose isomerase [Candidatus Blochmannia floridanus]
Sequence
MYSNIIYNEFDKIIKIMQTFIKTENYVNKIQSAAKLISNAFKAEGKVLSCGNGGSHCNAM
HFAEELTGRYRANRPGYPAIVISDPSYLSCVSNDFGYENIFARFIESVGKSTDILFAISS
SGKSKNILKAITSAYNIGMKVIFLTGDGSCKQISNYVNVEICIPYAEYLDYVQEIHIKII
HTIILIVEKEMLI
Download sequence
Identical sequences Q7VQB4
203907.Bfl226 WP_011126507.1.13780 gi|33519692|ref|NP_878524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]