SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33519910|ref|NP_878742.1| from Candidatus Blochmannia floridanus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33519910|ref|NP_878742.1|
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily SIS domain 6.01e-50
Family mono-SIS domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33519910|ref|NP_878742.1|
Sequence length 326
Comment D-arabinose 5-phosphate isomerase [Candidatus Blochmannia floridanus]
Sequence
MINDKLLLQYAKETLAIEIDEAQHMLERLDDSIVLACRILLECKGKVIVSGMGKSGHIGK
KIAASLASTGTSAFFVHPAEALHGDLGMIGEQDVVIFISYSGYAYEIMTLMPLLSDSGIP
VIALTGDLQSPLAVGAECVLNIKRKREACPMELVPTSSSVNALMMGDALTISLMRYKGFS
TEQFARSHPGGRLGSKLLNCVHHIMRVGEHISKVFCTGTVMDAMFELSRTGLGLTAVCDI
NDHVIGVFTDGDLRRWIVQGKSLTDSVNLAMTCPGCVIDRDWKVDVALKMLHKLNITAAP
VVNKLGIIVGSINVHDLHRRCNGIIK
Download sequence
Identical sequences Q7VQX4
gi|33519910|ref|NP_878742.1| WP_011126725.1.13780 203907.Bfl459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]