SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0350.2f.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0350.2f.1
Domain Number 1 Region: 426-815
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-129
Family Ankyrin repeat 0.00000000181
Further Details:      
 
Domain Number 2 Region: 114-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.49e-92
Family Ankyrin repeat 0.000000681
Further Details:      
 
Domain Number 3 Region: 36-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.96e-24
Family Ankyrin repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 1497-1581
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000188
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: B0350.2f.1   Gene: WBGene00006780   Transcript: B0350.2f.1
Sequence length 6994
Comment pep:known chromosome:WBcel235:IV:5975557:6004859:1 gene:WBGene00006780 transcript:B0350.2f.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDIN
TSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVE
NGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV
VAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHE
NVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCA
ARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL
TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEA
TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN
GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVA
GILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY
NNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPL
HLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTN
AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS
PNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMNETMFS
ESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKI
NSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEE
LVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSKLQHRTFLISFLVDARGGA
MRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKF
LGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQL
DDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKT
IKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQY
SGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTP
RDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLI
AKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAAT
EGRIGFMAEPKIRSDALPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEK
DLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKNTLKIWIHLKKEDAN
QDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIRHFEEVPAATLVKREV
RTEDLVTREPVQPTHHVEQATTVVQEPSYSAPVHHSPVPEEPEMEEEAPVAEMRTVVRTE
RHVHDSEDGPVVEERTITTTYEDDVAVNENIVDRTVPLNEDEQQKWEELNRLADESSPSP
AQRSTIVAESTSEQVPEDVEQSVESESHREDDGTIVTTTVTTSHISESPSGSPTRRSVEP
EEHRHSQHEDHEASGAEQHSGQDSGTTQKKETAEEGFTNEDGSVVVSKKMTRVVTTTRTT
LPGEGEEPSAPDSPVESLGSVKDRIAKFEQFKTLPIDPSVSGPPPSAHTLQSEEYQEESG
NVESAYDVETDRRDSERSLKSERSIPEIHTSPSEEQQSEHFESAEHTEDQGRDSGRSLKS
DRSIPEVQFTESDSELEKHDLHEDSHLEPTVGIVITPHTPVPPEHPDDKEDIEDEQPQEP
LEPSEPEHVAHAELKDTREYSDEELAQELSPSEEHVSTAEIKDIKSYSPTSSDDERSSQK
GKVSPPIPQVRHAISPSVASEVLSSHDDELAAHFVAESFEKHDEGNVETIEQTPVYKGHH
SPGQTSPIVSEHPHAQEYAESVTSHDEGDNLSLKSGHEPEIARHSVASVQEEDDDDDEKS
ELGDFAKKAGMIVGGVIAAPVALAAVGAKAAYDALNRDDDEEKLEGHEEKEVLTTQTTIM
ESPIRHEDIPSPHLEDVTPKVSHQEHPYEHVTETTTTVTRDYYEQPEDHREASPAPSSHV
ESERPISESPAVSEREPSHIATETTTTVTREYDQEPKADQSSARESVRDLVSEEHEHPAC
DSERLSEPAQSPEPVETHAESQFSNLVETTTTTAVTREFYDEDQEEQASSRATKERIEQS
PVASERSIVSTEHRQSPTQESEQSLEPTSEKNVHTVTETTTVTRECFEEPIASELEHASR
EFEQGSNDFRRSVSPVDAQEQVDVPHSPAPSSHAESEQPVPESPHHIVETTTTTTVTREF
QDEEYPRPESPAEIFPIPSSEQQSEEPHIVKETTTTTTVTRELYDEPEKGNVTFSPAPSS
HAESERQVPESPVVSHQEYPHVVETTTTTNVTSNIYDDEDNVPSSEDPATQHFQQSETSV
HRSHPDSVEESDGEGLGSKVLGFAKKAGMVAGGVVAAPVALAAVGAKAAYDAFEKDDEDD
ETSHSPESPVPEYQSEQYQDDSAQSSHTDFEHHMPESPIEHEKETEEFDHSHPESPVLSE
KEREHQVTSETTTTTTVTREYNDEPEDEQEHQGPHSPAPSSHTEAEHPHIVETTTTTTVT
REFQEEPEELEYKQEDNSRKSPSSHSQENLVTETTTTTTVTSEYYDEPEHFEEQETGKSS
PAPSSHVESERQVLESPVASDPRHVMETTTTTTVTRQFHDDESERSDSPNRDVVEAQSIH
SSNIESHQQFSEKDDDSQRGPSPVKSEDEPVKHESYKFETSTTETREFDRPELDSERLSE
PAQSPMEVSPITTEENIVRPSSSVKSEYGSEGHVPSVIETKTTTTVTREFYDDDQDEHEN
QTQSEELRSSIPTEEEEHEGSHLFKETTTTTTVTREFYDEPENVEELQDPQFSPAPSSHV
ESGIHASESPVAQQQEIPQTREFHEDSPAAQYFHEEEYESHVLTEQAPLLTEQQHQPESG
DESDGEGLGSKVLGFAKKAGMVAGGVVAAPVALAAVGAKAAYDALKKDDDEEDQEERESL
LRQERSIDSPHASEQSQIEEEHERFEESPVPSEKHHVTETTTTTTVTREYFDEHEPLVSQ
EIEGEKGSPADSEKSLPHVVETTTTTTVTREFDKNDSESPVPSEKEQEPTTVSREVYETA
EGDEPEHHYTETTTTTVTKEVIDDSQEMGDDDEPKQESPQVVETTTTTMTSREYDDNDDE
TRSEAGDSHITETTKTTTVVREFHGEQPEETEETDEVEELPPKIEEEDNVSEYSESSTSV
SREVRPDEPHIIETTTTTTVTREYHNEPEETYDDQKDAAPISFSQEHQDDDSQASHDQHD
RESPVESEKSVKHTTETTTTTTVTRQLYDDEASEIRGESPVATEEHEHVSSTKSDDESEQ
HVPSVIETTTTTTVTREFYDDQDELQREDHTQSEERRSSIPTEETEHEDSHLIKETTTTT
TVTREFYDEPENVEKLQDSQFSLSPSSHVESEIYVPESPVAKQQEIPQTREFHEDSPAAQ
YFHEDEYEHQVPTEQAPLLTEQQHQPESGEESDGEGFGSKVLGFAKKAGMVAGGVVAAPV
ALAAVGAKAAYDALKKEDDEEDQEERESLIREERSFDSPHASEQSQIEKEHKRFEESPVP
SEKHHDQSSALPQESVSQPIEKESRTFNDESEFGVKSDHYTEDDQESLKSPKESGEAFSQ
FTSEKEQDRSDSPIHSQKEDISQFQNESSPEDVKSEQPHDEEKPDLERQGSYSSGYSPKS
PGGSITGLDEEKALSGVQEPEDRPENFAESHEKTEATSDENLFESDKYAPASPVPSEDSS
NRVIETTTTTTVTREHFEPEDDHSYVVESQEYSSSGSPVPSEKSVDRVIETTTTTTVTRE
HFEAEDEIPTIVESSHDDQAASPVPSEEDVHEQIQTTTTTTTVTKEHFVPDDEIDSEHMN
ESDKYASGSPVPSEEDSSRVTETTTTTTVTREHFEPEDDHSPVVQTQEYSASESPVPSEK
SVERVIETTTTTTVTREHFEDEDHILGQQGESDSQIPSESITSENMDRETSSSPVQSNRD
EEFVLPAIAPYKQPTEYGRVDSHDAPASPAPSAESPIQAYKQEESQEAHSLEQFQQRSSV
SHEDSPAAQYFHDNESDHDSPVPSDRAPLLTEQQHQPESGEESDGEGFGSKVLGFAKKAG
MVAGGVVAAPVALAAVGAKAAYDALKKDDDEDENPDEQEKLLPKSPERQVLVNPVEPSDS
EISEIELEYTSPSPTEKSESQCYTETVRTTTVTREYLDDPQSVTRSRSPSEHDISEQYAP
ESPVEQDPYVVEKTTTVIRQYHDEPPQEIEEQTIPEEVTVLREVYESPEGDEPEQHYIET
KTTTTITKEVHVPVEEDVQISPVHSETSVSEKQLPADEQLDEPVTESTTTATVTRERYEE
PEEVRPPSGSEADDESHAPKYMETTTTTTVTREYEVSEDEDEHQQSQVQRDESPAPSEDS
VKHVIEKTTTTTVTEERYEPEDSHSPVPSEDDVHGFVKTTTTTTTVTHEHFEPEDPPSDE
HVVESERYASGSPVPSEEDSSREIETTTTTTVTREHFELEDDQEHVVESQEYSASGSPVP
SEKSVERVIETTTTNTVTREHFEHEDDIPTIVETSHDDPAASSVPSEEDVHGQIQTTTTT
TTVTREHVVPDEEIDSGRMDELEKYSSESPVPSEEDSSRVIETTTTTTVSREHFEPEDDH
SHVVESQEYSASGSPVPSEKSVERVIETTTTTTVTREHFDTEEDYIPSESRTSHDDGITD
QHVPSQSPVPSEEDDHVTHEQIIRDDPIDEQIVESHEYKSESSIPSEQDSTHVIETVMST
PITSERYDPEVEKDVVESADDEIDSSTAQYYKSESPVQTEKSLLLAKQQQESGDESDGEG
FGSKVLGFAKKAGMVAGGVVAAPVALAAVGAKAAYDALKKDDDEEDQEDKEPLIGGFHKD
QDPISQDEPSAVDSETQEPGATFYEPEEEDKVITDSADSSVVQDEPKIVFPVDSTPEHHS
NDREEFESIVKSEGPYIVESTDYAQTSAEEPRISSPVHSDAGDASSFKRPESVTGEDEKN
AIPETSETDAPYVIDSEEYEFNNRDEQRISSPAHSDEEDENDAEVIDSEFYRHSQEQNNE
EDPSIVESGEYISSGHGSPRPFEDSTTTTVLNVHHEPAAIPEPEVDEEELEQERSIIESE
EYKTSSPLPPTSVTTVEHVEPAEIHKYRTTSPTIVTTVSSEHLDRNQEPYVVESEEYTRA
SPLGPERPESPSGSPLPREEDDSHVIESHEYTSSPVPSEDSVKHVIEKTTTTTVTEERYE
PEDSHSPVPSEDDVHGFVKTTTTTTTVTHEHFEPEDHTSDEHVVESERYASGSPVPSEEN
SNRVTETTTTTTVTREHFEPEDDQEHVVESQEYSASGSPVPSEKSVEKVIETTTTTTVTR
EHFEHEDEIPTIVESSHDDQAASSVPSEEDVHGQIQTTTTTTTVTREHVVPDEEIDSGRM
DELEKYSSESPVPPEEDSSRVIETTTTTTFIREHFEPEDDHSHVVGSQEYSASGSPVPSE
KSVERVIETTTTTTVTSEHFEHEDEHAQLHDTVSSEKTSSSEPVEQTLEEADITEETHQR
FSAEDEHQPTSTEKPVHGFMETTSTSHTASHVELEHRDDDDESGGEGFGSKVLGFAKKAG
MVAGGVVAAPVALAAVGAKAAYDALKKDDDEEATYDLDREHGSYESAELQRPTQQVESRQ
EDSESEGSFVDHGEDSQHLPVQSTEAAFKLSSEDIAEQTAEKLVSEVFAPLDRTLIESEQ
YRASIESLNRRSPVEPKRSVEDLASEALQNVTKISFGHADESDDKHDGDNDGEWKVYDRH
GEVLEEFSTQLTDDVIQEAEGDATTHIMMTQAEYSPRRSKFLKQESCQEISNEPEVDYYS
DLQEKLNILAGEKNNLHALVEEEPSSSASDQLDVIHESDQEAHLEQEHQQEAAAQKEQDE
KEEAAEYTATLLVDDVLQQVVQEINEEDDDKKTMTSTSYLTATEKDDQEYDTCVTSQDDT
YESAQGWTSQDSEYTTATSQAPSRLSDSDAELTARDHDQERQETSTPQAILSPVDSDRHF
TVQQDFEMPVIRAFDPDDFMQTTARSTPDVALQVTIEEEDESDDKLPISPSGILLPPKHD
PGRPISPVPPRKSDGTMQKEGDHFVFVREEDTIAEPTPPPQPAEPEQLAEYEATKESEHQ
QITEGDVPQEEEETEMRRQETERIHSLAMEASSDLGNSESSRYSRQLSDLSSSAESHADT
VIRVESERSGSSDSLEVVSVISAGKDAQMSEKSLTPEDPEKPTDSVQEHQQKDQEQAEAE
DQREAEDLGFEVYDADTEEQNQQLEELETVEEEPEDSDSLNEGGNHSSGHSSVGVPADTL
AMIGKYRHQSSDNLSLTSLQEFERLEKEVGARGDGSLTRSEIELLVAGRLNKSGEGSVSS
LAEFERLEKEMTENQSPPEDVMMLSDIREESEAEDMSIRDDDEEDAEGSDTELKSRPVQE
EDLRVITPIAPSPTDSLDHAVDAVQMQYLETSTDSLEPTFQEIEVEQRPESVEDTSLTEY
EVIPRVMEASTTDSLDGTATIEKDSVLEGASQGIESTQSTHGLLSGDTMGTVVTDDDRDS
LDGEMSSMLQSYPTTLTTFQTTVVGPDGSLQTISRRVETKVTDPLVSHVTFTGTESQERL
DQLPDDEQFETVDTEGNVTRTTFHREHDQQQPHF
Download sequence
Identical sequences Q17490
NP_001021268.1.50509 B0350.2f 6239.B0350.2f.2 B0350.2f.1 B0350.2f.2 B0350.2c.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]