SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F08B6.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F08B6.2
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000000106
Family Transducin (heterotrimeric G protein), gamma chain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F08B6.2   Gene: WBGene00001682   Transcript: F08B6.2
Sequence length 62
Comment pep:known chromosome:WBcel235:I:6757460:6758179:1 gene:WBGene00001682 transcript:F08B6.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQEDPLVNPIDKKVNPWAEKSKCS
ML
Download sequence
Identical sequences G5ECT6
F08B6.2 F08B6.2 F08B6.2 NP_491935.1.50509 6239.F08B6.2 F08B6.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]