SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F26G1.4.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F26G1.4.2
Domain Number 1 Region: 4-157
Classification Level Classification E-value
Superfamily E set domains 0.0000168
Family Arrestin/Vps26-like 0.055
Further Details:      
 
Weak hits

Sequence:  F26G1.4.2
Domain Number - Region: 193-325
Classification Level Classification E-value
Superfamily E set domains 0.000168
Family Arrestin/Vps26-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F26G1.4.2   Gene: WBGene00017840   Transcript: F26G1.4.2
Sequence length 358
Comment pep:known chromosome:WBcel235:II:4764160:4766386:-1 gene:WBGene00017840 transcript:F26G1.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDKIRFTVLLDRPFYQPGQTIQGHVVCEPHHPLEIDCVEGRLHGEIQYFQQLPPNHNRN
GSPLPPSKTRVLIDEKAQLWKYQTVSEMLGLDVFYDENQNRHFSSESASASSSSLFTTAA
TFPIQIELPHFAPPSFYCPGSPVSIRFTLEIQLYNQGFKIASHEENLVVLNYESIKRQVT
PKPVNFQKTFNFPKERSISLEMLLPTDVFTTTARLENCITICNRWKQSLKYVHLNIVRRI
SALNQNNEVIDTVKIDTTGVGLPSKTKIAVGETYSFRPTFNVPALPPNIHVNGLFKTEYS
LKVTIGRAHNFVLASYEVPITIVTMDQSSRRSMQKEDILVDISASNNTLNNLPVDLLA
Download sequence
Identical sequences Q19829
F26G1.4.1 6239.F26G1.4 NP_494855.1.50509 F26G1.4.1 F26G1.4.2 F26G1.4 F26G1.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]