SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F58G1.6 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F58G1.6
Domain Number 1 Region: 174-337
Classification Level Classification E-value
Superfamily E set domains 0.0000301
Family Arrestin/Vps26-like 0.025
Further Details:      
 
Weak hits

Sequence:  F58G1.6
Domain Number - Region: 95-143
Classification Level Classification E-value
Superfamily E set domains 0.0119
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F58G1.6   Gene: WBGene00010268   Transcript: F58G1.6
Sequence length 421
Comment pep:known chromosome:WBcel235:II:12938869:12943867:1 gene:WBGene00010268 transcript:F58G1.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKSGTFSTDIFFEKFPIRMKQKRAIRLLVPDRPLRAGCKELVELSLRIPNAVQILESN
AVFEGVCRATFSGQDSQHTLIKEQLHIPFTAIQLPTTKGIDVIPEGHHRLPIFLNVPHHM
PGTFNGKFGAIVYRFLIKLKVKRFSSGDEGTIECEKAVDVLGRISLEQQPSFAQPVSIDR
HVKKKAFFMNRLEAHIKFEIERAAYSVGDHILVTGEIKNEHLSNPIKHVALELRQHILYA
SGDAQRSDTRLITRLILGSVPPTETFAVFHSFQVPFDCYPSLVWNGNPVQVTYELLLTNS
GCFEIGTPVFLGNYGSPNSTRRSIMYPESTSGEAPPSTTYYCVPPSEMSFTVDPPPYSTF
GAKTDPVFIPIHMLKTPYRPFAPAYHMFRNHGPPKYDFNSNQRMMAESPPPQRFLKIEEI
E
Download sequence
Identical sequences O62274
NP_496757.2.50509 F58G1.6 F58G1.6 F58G1.6 6239.F58G1.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]