SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K11D12.2.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K11D12.2.2
Domain Number 1 Region: 298-354
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.97e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00038
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000204
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: K11D12.2.2   Gene: WBGene00004136   Transcript: K11D12.2.2
Sequence length 354
Comment pep:known chromosome:WBcel235:V:5049743:5052215:1 gene:WBGene00004136 transcript:K11D12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGNGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLESNAP
PPAPRQQHHVPPSAVRPNPMPPQRPVAQQPVRALSALHAAHIGDAPIRMAYTGQPTQHPS
QVRMFNPQFQGGIHFQPGQVFVVQQPNGQNIPMSIMPNQIPQHRIIHQGQPQQAQQQQPQ
QGNQLTHMNQMDGNVGSESDGEGPSGPVKLAPKKTKCSLRVRGSGASEKKAMKVLGSLLK
DFQLDGGGGGMSDSSSEDEPDDDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQSDD
EDLTMLFEADNVVMCQFEKVNRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Download sequence
Identical sequences O44625
K11D12.2 K11D12.2.1 K11D12.2.2 K11D12.2.3 K11D12.2.4 K11D12.2 K11D12.2.1 6239.K11D12.2.4 NP_504355.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]