SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W03F11.6a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W03F11.6a
Domain Number 1 Region: 950-1054
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-23
Family PDZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 351-453
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.91e-18
Family FHA domain 0.00075
Further Details:      
 
Domain Number 3 Region: 36-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.53e-16
Family Ras-binding domain, RBD 0.0076
Further Details:      
 
Domain Number 4 Region: 217-318
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000207
Family Ras-binding domain, RBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: W03F11.6a   Gene: WBGene00021009   Transcript: W03F11.6a
Sequence length 1658
Comment pep:known chromosome:WBcel235:I:2160042:2209635:1 gene:WBGene00021009 transcript:W03F11.6a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEREQLACLVQQWNENRLDLFHLSYPTEDLEVEGVMRFYFQDGGEKVLTKCVRVSSTA
TTRAVVDALSEKFLPDLKMLSNDTYSLWEVHENGEERKLLDEEKPLVVQLQWHKDDREGR
FLLKKDAAPPVSLLNLQEADQKNTRFAKKKDKEPKKKNQKNFVQVNGGREEAQSQDDIYK
QVPFNTFTRTISNPEAVMRKRREKKLETKLKEMMFGGSLKVYGGEIVPTRPYVSILAEIN
ENADRILGAALEKYGLEHSKDDFILVEVSNDDDRKSMSDLREIDGRPIPPTECPLFEMTA
RSGNGENGFDSFLAIKRKPHDYQVPSTSVVAPSSVTLPMSPLTSLPPQIHNLPVLIVMNN
DGHLSTHRITLHEGVTEVGSDSQMSNFSQHNIYLDGPDIRGRHAAIAFMEGVVTLTPSTR
DAYLEVNGHQLMQTEILRDGDHIRIGADHSFKFSTSSSQANQINSTNISNSNQRHFQQQT
FYPEMADSRASTARCAPSDYCSLPQQNDYYPPSMSGSSVSSSRQEDLMMHSNNNILPPYS
TKSAQEPLQLPLSIQIGDYNVWDFLAEVMSNRAATSSEMSTFRLSPAYSLYLALRSFHTH
NKPYSVQFFSRIESNFKQIAQECSSKDDLIFWLANASEFNHLVERDTELKASRYGKISVE
IERIFRRLVAVLQSVIRPAARALLDIHLNDHDATGDVIHLLDTTMRQARICGLNAALTIQ
LCGHLLHMVNAFVFNSLVSVNLPAAQLNTRLGKCLQYRIESIHRFCERMGVEMAAECHLD
RSRQAANLLATQKNDVAALGSTCYKLNSLQVVHILSGFEPDDGEIPCDDDVVDRICRLAE
KQADKLTLEDGQRVTLEESDELNLPFLIPQDGYFVEQFRTVPDGLWQYLQQLQHRRLCHT
VSLTPAPPAAMTHSMHAMHIGASDAHYHQHQHQQQQNPIVRSVSQTTLTSIPTTQFGDSF
GSAVSDTISKVTLRKNGGGIGLSIVAAQGVGDRQMGIYVKKVVEGTPAAHDGRLETGDQL
LSVNGHSLIGISQEDAARLMTQSGNEVHFDVRKRAAHRNGLSNWLGSQTPTTSNFIAPSP
STVPPPSYSHVGRTPSYDGQPPPSYNHRNGGASGAGGSSGRNSAFVAPLSNSSSNASSSH
MQQHYAHHNMMHNGNLSAAPGAPAGDPKHYRSSSASDLQHDPNASFSQSSMTGSARSSVF
DKLPSHYRHSTRPTVIQPTRPSAQSPSALRKAAAASPVSNLYRPTSASNLFAPPRNSGGL
VGYSSNAARESTQDIHRALNDLELNSPLARSTPNEEYRIPPPRVPTVTSTSSNYAPLHSI
RPASMYGYQSPSSSTTVIPAPKGVASSSNNTSPRVNVTLGGALSSSRSHNSLSQEPAIVI
RPVDLNMPKATPPASIRGAVPTAITQALQLQPNGGGAVLRQVRPASGLRERLQDADVRNL
EKTNTALMSYEAVNEELDRLDAKQNTMTIDEQRRYRELLNVVAEQSRARKLLSEIRSPPT
SYQEREIPIHVQKEQQQHRRETVIDDIPHSSSSVENVSPVSPPESRKVQFIDEVVQYQTP
TSGANHAFFDDVPVLDSPGIVGTNEIYRDPRQRRLNELQDRNRSSENGAADGAKLGFRDK
QRLFARQIGEDTAPRQRMNESSAQRLIETDIAATPQKP
Download sequence
Identical sequences Q9BIC1
W03F11.6a NP_490938.3.50509 6239.W03F11.6a W03F11.6a W03F11.6a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]