SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y16B4A.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y16B4A.1
Domain Number 1 Region: 268-356
Classification Level Classification E-value
Superfamily E set domains 1.12e-18
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.088
Further Details:      
 
Weak hits

Sequence:  Y16B4A.1
Domain Number - Region: 363-404
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0371
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y16B4A.1   Gene: WBGene00006743   Transcript: Y16B4A.1
Sequence length 491
Comment pep:known chromosome:WBcel235:X:14773538:14783564:1 gene:WBGene00006743 transcript:Y16B4A.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTAPLRAGQMNFYDEPYNPVLNLHIQPSVKDENQRSTWPIIDTSNTSTQIARAHFEKH
PPNNLRKSNFFHFVIALYDRNSQPIEVERTQFAGFVEKEKEVDGQDTRNGIHYRLSLMFQ
NGIRSEHDLFVRLIDSSTKQAITYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETP
SDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVLCSSARIDGPLLAVSDNMFVHNN
SKHGRRTKRTDASDDSEYSESAELPSSVPVIKALFPSEGWIQGGTQVVLIGENFFEGLQV
AFGTASPNWGESVQLISPHAIRVTTPPKHSAGPVDVTLQYKSKTYSRGTPLRFSYITLAE
PGIEYGFQRLQKLLPKYPGDPERLPKDQILKRAAELAEALYNRTSTESLSSYYHTQFDAT
SDYAARTHTSPRSTLPYGAGPPALSSAVYQTSYPTVNATPAANFLNTQTGFATFGAVNPF
AATLQSSSRLS
Download sequence
Identical sequences Q93705
Y16B4A.1 Y16B4A.1.1 NP_510453.1.50509 AAC06226 Y16B4A.1 6239.Y16B4A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]