SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15835151|ref|NP_296910.1| from Chlamydia muridarum Nigg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15835151|ref|NP_296910.1|
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.23e-63
Family Phosphate binding protein-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15835151|ref|NP_296910.1|
Sequence length 256
Comment conserved hypothetical protein [Chlamydia muridarum str. Nigg]
Sequence
MTFSVAFSPCPNDIFLFRSFLEKHEGAPSLRQIMIADIASLNHLALETRFSLIKISASLY
PRIADAYHVLDVGTTLGHKIGPLVLSKHPDKLLRTLATPGETTTAHALCRLFYPQTELIP
MKYHEIIPAILANQVDGGAVIHEERFSFPKELCLVDDLGQLWEEKWHLPLPLGCIAISKE
ISADDSYRLNYALLRSLRRSLTESSLAIQKASEYSRDKNAATIQRFIDTYVTEETFCLSP
IGREALSTLWTACRNV
Download sequence
Identical sequences A0A070A0Y5 Q9PKD2
243161.TC0533 WP_010230691.1.18971 WP_010230691.1.19393 WP_010230691.1.21797 WP_010230691.1.40339 WP_010230691.1.40903 WP_010230691.1.45721 WP_010230691.1.46238 WP_010230691.1.60880 WP_010230691.1.63773 WP_010230691.1.69188 WP_010230691.1.77803 WP_010230691.1.85209 WP_010230691.1.89087 WP_010230691.1.91588 gi|15835151|ref|NP_296910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]