SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15835189|ref|NP_296948.1| from Chlamydia muridarum Nigg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15835189|ref|NP_296948.1|
Domain Number 1 Region: 19-225
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-55
Family Phosphate binding protein-like 0.0000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15835189|ref|NP_296948.1|
Sequence length 242
Comment porphobilinogen deaminase HemC, putative [Chlamydia muridarum str. Nigg]
Sequence
MLSAYYNDPFLSDFCLGKIPLRLASRKSPLAVLQAHECLRRLQTFFPRLWGQVITETTQG
DLDQHTPLHSVENTGFFTDDIDFLVQSGKCDLAIHSAKDLPEKPKARVIAITASIDPRDI
LVFQEKYLLQPFPSRLRIGCSSDRRRALISSLYPSAVITDIRGTIQTRLALLDQQKFDAI
VMANAAVSRLGLRLPCTVVLPPPYHPFQGRLAITSCHHIASWEKLFLTCKITENINLLHF
FS
Download sequence
Identical sequences A0A069ZQY1 Q9PK95
243161.TC0572 gi|15835189|ref|NP_296948.1| WP_010230871.1.18971 WP_010230871.1.19393 WP_010230871.1.21797 WP_010230871.1.40339 WP_010230871.1.40903 WP_010230871.1.45721 WP_010230871.1.46238 WP_010230871.1.60880 WP_010230871.1.63773 WP_010230871.1.69188 WP_010230871.1.77803 WP_010230871.1.85209 WP_010230871.1.89087 WP_010230871.1.91588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]