SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15835326|ref|NP_297085.1| from Chlamydia muridarum Nigg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15835326|ref|NP_297085.1|
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-50
Family Phosphate binding protein-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15835326|ref|NP_297085.1|
Sequence length 266
Comment conserved hypothetical protein [Chlamydia muridarum str. Nigg]
Sequence
MSRQFRSCLTVGCVCYVNALPFSIGLSQAPGVSLQTDTPSNLVSKLLSKEIDYALTSVIA
KFSSPLHQVSFFGIAAYQKILSVNLHATPQFFAKEAPRIAATKESRSSIALMRILCKNLW
KIPFPSITLLSSKEILDQVELYDALLLIGDTALHHQIIPGFQTYDLVTSWHDLTSKPFVF
AGVLSHSSTLPLQLQQEFFSSLHYFQDHREEIWRKAAALLKLPESLMQQYYSLCRYELSE
EDFAGLQQFKNYYDKLPRQAEHPNHV
Download sequence
Identical sequences A0A070A4M0 Q9PJW5
gi|15835326|ref|NP_297085.1| WP_010231288.1.18971 WP_010231288.1.19393 WP_010231288.1.21797 WP_010231288.1.40339 WP_010231288.1.40903 WP_010231288.1.45721 WP_010231288.1.46238 WP_010231288.1.60880 WP_010231288.1.63773 WP_010231288.1.69188 WP_010231288.1.77803 WP_010231288.1.85209 WP_010231288.1.89087 WP_010231288.1.91588 243161.TC0711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]