SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C16C2.2a.1 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C16C2.2a.1
Domain Number 1 Region: 273-408
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-36
Family Regulator of G-protein signaling, RGS 0.000036
Further Details:      
 
Domain Number 2 Region: 8-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000517
Family DEP domain 0.025
Further Details:      
 
Domain Number 3 Region: 204-261
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000235
Family Transducin (heterotrimeric G protein), gamma chain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C16C2.2a.1   Gene: C16C2.2   Transcript: C16C2.2a.1
Sequence length 473
Comment pep:known chromosome:WBcel215:I:9722712:9725602:1 gene:C16C2.2 transcript:C16C2.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPPLTKIEVLAKRVMEGAQLKTHKYFRIAVPHAITGQQLIALVLERGAPDDEAEASHLA
SLLLHHGYMFPVIEHGQPFKDDGTLYRLQRPYFWPSQAELVPDVEYAIYLNKRLLRNEQK
HGLEEDEVESFNRLADVLAHMWAFIVQQSELQLKQQKEKKKVDKVVFDSEERAFWKIRKP
SRGGPNFLEDPYMKIEKKIRRQNAQGYRCLMDRLRFAIKTKPWLKALKASDTMVTWVDQR
AEFDPFLHPPQPSNPWISDEASFWNQPTDTSSAEIPTEKRVKRWGLSVQELVKDPIGRQV
LETFLESEFSSENIRFWIAIQDLKYAPNEQIYQKAERIREEFLAQGAPAQVNVDNRTLDQ
TLECISKAKDASQMRFAFYHSEEHVFTLMAKDSYPRFVRSQIYKAVLTAAQQHGTKRLGW
RNFVFNMGTTKKPATSKPAKPQDSIGTGQVLPKQLSSDSLPVRQAHGVKPDPE
Download sequence
Identical sequences O17589
6239.C16C2.2a.1 C16C2.2 C16C2.2a.1 C16C2.2a.2 C16C2.2a NP_740904.1.50509 C16C2.2a.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]