SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K02A4.2.1 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K02A4.2.1
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.31e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: K02A4.2.1   Gene: K02A4.2   Transcript: K02A4.2.1
Sequence length 62
Comment pep:known chromosome:WBcel215:X:12881520:12884919:-1 gene:K02A4.2 transcript:K02A4.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENIKASTEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQHNPFQEKKSCS
VL
Download sequence
Identical sequences P54406
K02A4.2.1 K02A4.2.2 NP_510145.1.50509 K02A4.2 K02A4.2.1 K02A4.2 6239.K02A4.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]