SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZK809.5b from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ZK809.5b
Domain Number - Region: 304-336
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0785
Family Transducin (heterotrimeric G protein), gamma chain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK809.5b   Gene: ZK809.5   Transcript: ZK809.5b
Sequence length 708
Comment pep:known chromosome:WBcel215:IV:11656707:11659402:1 gene:ZK809.5 transcript:ZK809.5b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKQQIGVLKRDGIGKQYFDMENILTRSLYRVLNSSTQVPPHIVTKSQNVDKMSFPDRK
SFQTIAVARPNNHQIGNASSVDMDMQMRLLAQEICGRVERKYERKLEDVRERDRRDTERR
LISIRSEYESKYQLQLGKLEKEKNRLLDQIAERERTLEHRMEMRSAEREHDLVAKQRTVE
NRAIELTLNKENFEKCRDEWQRKMELEMEELRLERERIEVASLKSTDKRRSDMAIEAEIS
MWKKRTAELEHDANETRKRVGEMMEDNFRLKNQISSVGQIQKELDVTMTSLNETREELAV
SRVEVRRTGDYDQLKEENDQLRIEIELLRQKTSQKVKIAVEETIAEYSAKEAKWKRIAGL
SQQRIAVLSEKLKDSEIERDVLRQEMKTMQKMVGRSSAGRQGHNQKNTESRKIIRSISPS
GSTSSLSDGELEILNIRQRIQNLDDIAKELDASVEHFSTGGASRKLFDKNETNVELYDDF
CRALHSSVMDEEGSPLHMTSSPQKPTQNHKRKIEIPVNEKSMVSTSQVTDQDEWLKRGIR
VISPPAMKRSPVVRPESPEVILESEKIEVKIEQPPVKTIEPELTEFEKRMQARSAAKDDT
DRRNRILQLATDPETSIVKPKSPEPTEEPAKPTSADNPMFAGVDPVMAEYMKKVLAARNQ
NQTTLSAQPTIQVAPVVVPPKSTEVEVTLADELDLELDQPTNADDDWW
Download sequence
Identical sequences Q86D01
ZK809.5b NP_001023625.1.50509 ZK809.5b 6239.ZK809.5b ZK809.5b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]