SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C35A5.4 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C35A5.4
Domain Number 1 Region: 74-190
Classification Level Classification E-value
Superfamily PapD-like 0.000000000000419
Family MSP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C35A5.4   Gene: C35A5.4   Transcript: C35A5.4
Sequence length 427
Comment pep:known chromosome:WBcel215:V:10497036:10499387:1 gene:C35A5.4 transcript:C35A5.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYSKSGKKKKVAEPAVQKIRKSREEDKATPCYLSNDGFLWTDNNPDLKLIEPRILVST
NYNYLEFSRKADRPPERRVLTLINHGDHPVAFEVQTTDNYSYFIDVVHGIIPPRQTSVNA
AIRMPNSVCIQVYHRPYNAYSAERQSDFFNRPRKDKMSILLAPQICQTFSPEAIFHNERS
YEKLRIMLKYTGIEEKSGDGRPKQFILHGVPGSATWKDDSGIRKTKNEQQMLEFKKIEKT
IIQNASKEVCEEMSKKPIIRRPSPLRARSKTPGSKDNKNQRDKREGGVMKMFRNLNPFDR
TPTPTTKKTQSVTPSNSTPSPAKPATPTKTPTPTKKPVENNETLSQVKTVSKALSHSPKS
PKKNSQEKSAPPSPKLPPKTTAPTPTKDGGNHSPKTTNKALEPPPSPNRTHSPSAYQPAM
SPKPTGK
Download sequence
Identical sequences Q18471
NP_505693.2.50509 6239.C35A5.4 C35A5.4 C35A5.4 C35A5.4 C35A5.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]