SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for T05D4.5 from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T05D4.5
Domain Number 1 Region: 129-227
Classification Level Classification E-value
Superfamily PapD-like 4.19e-16
Family MSP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T05D4.5   Gene: T05D4.5   Transcript: T05D4.5
Sequence length 482
Comment pep:known chromosome:WBcel215:III:13580749:13583517:1 gene:T05D4.5 transcript:T05D4.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQILSPASYGNRAPQKKKKPKKPSAELPSRHSTRSDENSGKIEPGTEHMSSGQRKNLK
LLKSDERARVIDARAVLDSAQKHLATLLKNGGKGGDEDIDELIFNREAEIPVEPIRKGKC
PFYFDQRILTIVGRVGEVPVQHWFAIYNTSPFPYMFKIKCSDNSLFKIHPVCGVLDALCD
AEISVTFVGAHVPPRYTSYLSIHSMLPDPLFLDVPQAFRNRRNFETRQRLYVEYAYHEDP
ILVTAEEDRDQFHFQYMRKVLKTDEAESFAKKLKAEKVERLDKKIDEIKARKIDEKLIER
EIVRAESPKFEPKTRRLRVEKFFNQQKQKKENEWMEKLKVDASRKPMLSHWDLEMKNIKA
EKKKIGAVKKKIKAEKKEDKKKPMGWMSTLKMERDERRTKRKEEEEKKKKDAEEKKKKDA
EEKKKKDAEDEKKKDAGDEKKKDAEDEKKKDAGDEKKKKDAGEKKKKDAEEKKKVAEEEK
KS
Download sequence
Identical sequences O45751
T05D4.5 T05D4.5 6239.T05D4.5 NP_499807.1.50509 T05D4.5 T05D4.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]