SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Y37A1B.17a from Caenorhabditis elegans 69_215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y37A1B.17a
Domain Number 1 Region: 454-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-32
Family DBL homology domain (DH-domain) 0.00081
Further Details:      
 
Domain Number 2 Region: 170-237
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-16
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1449-1522
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000328
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 238-320
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000473
Family SH3-domain 0.0031
Further Details:      
 
Domain Number 5 Region: 788-867
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000279
Family BAR domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y37A1B.17a   Gene: Y37A1B.17   Transcript: Y37A1B.17a
Sequence length 1523
Comment pep:known chromosome:WBcel215:IV:13964336:13979822:-1 gene:Y37A1B.17 transcript:Y37A1B.17a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLSWVRISNATQDPETRCSVAQDQIVKVVREEGDWCHIQTIEGVSGRVPRVLTLPIVD
PKRQPDEQVYCSIEAYTSIRSDDLSFAEFSIFVAKPSRSNPGYLDGFLVNDNAVQIGRRG
LLPEAHLVNLHVSAESPMKPSFTTDFSEADVRFRTPATAPKAATSNYAVSPYARAVYDFQ
GEFENELSFSADEIISLRRRIDAEWLEGSIGSARVGIFPTSFVQIIVDLPDDDTTSLQNN
RRSTTTENDGIGFANVRHAFSGRQGDELTVNAGDTVRVLRMVNDEWVMCKDPDTEKTGIV
PVGFLEVYLDEEDDDNQSSNAMRRGTGGTSDFTFGSSNNRSSFISNAESSSDWRPPAGRT
NTDWATFEAVPPAAPASKPAQNWATFGEEWIAPVQLAKTSAPARPPPPKQSSIQSPINDI
GNVADMFGMTDTPKPSNPAIQSAGSDFEIGLISATEGASNDEDKRCRIIEELISSELQFI
SDINSYTEAVDGTPLLNQKQKVILKNGCAQIVQLSANLVQLLTNEQIKPQDAQLIGACFL
QLRKPFAQTYGFYFRNIEHINALTNSAKHEKTMESALQDIVKRMRESGSVVIDGPTAVSR
PIQRATKYPLFLNEIVKLTPLVHTDHPKLTEAIKQMSNLGQKMNESKRRKELTQKYMSDD
KQTFGEMLSKMTFHSLKKKSNRFTYRMGSSLGVVKLLRDTDFDRLVCELDSAERRLVRFN
YMMVIYRKKMFHETRVLMHKKVVEPRKKHLSSSEIDLQLQPFNHAIKTWASEANVRIRDE
IVKALRSIPKRLIKKRNDKLMDYEASRTKEKGLGKRDFAEIQKDYEALNTQVKQQLPKVT
EYLTTVLATSMRTVSEQDKALMETLRKLFNDAKSKAAEDQSKAARSLIIPTTICFVDYYD
QDRMKPLQKIANKAIQNMKQRARSVSPKGSKPGTSSSSTTVTESPWATAPTFIPPAATEI
LPTITEGSTSTHKFRNQNATERNTILEKATAKGRLGDIFVATSHYPQDSGMLKIALAEGK
LLIVKQNDLVLAVNREVPSMWLCYNGYYNAMLPSSILKPYTSIEKGVDVAKSAQFTGQTA
QVVAPQAPVQNQNAPKSQNLIDLEDLFGGPPQPAAAAHPTSLAFAPAQQQQNFATFDFTS
SPLQPTSLVPQAPAQNAQFDWNMAAKTLPLAPAPPMQVSQQAPQQQQQVQEGAGGANYNL
DLDNLFSGLSTIDWGAKTSTAPPPLYSNTPLDTATSPPVSAFRGVDFQTGVFNPNSLPDE
APPPLPVIVNPTRDDPFSTNFVPNFAAAAPATSPFGTASNSSVQFPVSFDEAPSSMGSLG
LPTGSMNQKRSASAAAQPTNVWPTTSMMSRSDSPQPLIPSRPEPAVKNVYPSLNDGSARA
PTFATTFPSQANQSLPMYSAVPNDTMSMNYAMPPMYDTTPQSPRVQLQQQHQPAAYDTPP
TIAPIYDQLPNESPASTAIRPVLCQVKVDYDFLPQGSNQVEVKEGEVIGVLQRTDDDGNP
EWLLIKRDSGKVGYVPAAYCRPV
Download sequence
Identical sequences G5ECK4
6239.Y37A1B.17a Y37A1B.17a Y37A1B.17a NP_001076722.2.50509 Y37A1B.17a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]