SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25027492|ref|NP_737546.1| from Corynebacterium efficiens YS-314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25027492|ref|NP_737546.1|
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily Formyltransferase 4.58e-52
Family Formyltransferase 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|25027492|ref|NP_737546.1|
Sequence length 211
Comment phosphoribosylglycinamide formyltransferase [Corynebacterium efficiens YS-314]
Sequence
MMVPDPTGINIVPVNSDSSTTIVVLASGTGTLLQALIEAQGNYRIAGVVSDVDCPAIQRA
TDAGIPARVVKLGADRAAWNAELADAVAAYKPDLVVSAGFMKILGEGFLSRFPSRIINTH
PALLPSFPGAHAVRDALAYGVKITGSTVHLVDAGVDTGPIIDQRPVPVEVGDDENSLHER
IKQVERKLIVEVLNRAEVSRTQGGVQLNWRG
Download sequence
Identical sequences Q8FR30
WP_006770099.1.13007 WP_006770099.1.3528 196164.CE0936 gi|25027492|ref|NP_737546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]