SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25027870|ref|NP_737924.1| from Corynebacterium efficiens YS-314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25027870|ref|NP_737924.1|
Domain Number 1 Region: 2-319
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 7.32e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25027870|ref|NP_737924.1|
Sequence length 326
Comment ATP synthase F0F1 subunit gamma [Corynebacterium efficiens YS-314]
Sequence
MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQKVLERLASAS
SLDHPMLREREGGKRAAVLVVSSDRGMAGGYNHNVFKKAAELEKLLAEQGYEVVRYVTGS
KGVGYYKFREDYVAGAWTGFSQDPDWNATHDVRRHLIDGFTATSDGTAKWRDGLNVAEGQ
EIQGFDQVHVVYTEFVSMLTQKPVVHQLLPVEPVIEDDIFERGESALSDGKNEIEPDYEF
EPDADTLLEALLPQYISRRLFSIFLEAAAAESASRRNAMKSATDNATELVKDLSRVANAA
RQAQITQEITEIVGGAGALSGSGESD
Download sequence
Identical sequences Q8FQ21
gi|25027870|ref|NP_737924.1| WP_006769275.1.13007 WP_006769275.1.3528 196164.CE1314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]