SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25028275|ref|NP_738329.1| from Corynebacterium efficiens YS-314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25028275|ref|NP_738329.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily Formyltransferase 5.89e-55
Family Formyltransferase 0.00000881
Further Details:      
 
Domain Number 2 Region: 208-311
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.65e-26
Family Post formyltransferase domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|25028275|ref|NP_738329.1|
Sequence length 315
Comment methionyl-tRNA formyltransferase [Corynebacterium efficiens YS-314]
Sequence
MRLVFAGTPEPAVVALQKLIDSEHEVVAVLTQPDARRGRGRTLHPSAVAELAQAHGIEVI
KPTSLKADTGDGRLVRQRLAELQPDCLPVVAFGQLITRDLLDVAPHGWVNLHFSLLPAWR
GAAPVQAAIRAGDQLTGATCFRIDEGLDTGVILSTLEETIQPTDTADDLLTRLAYAGADL
LVDTMTGLEAGTISPREQTGEATYAPKITTVDARIDWTVPAEVIDRHIRAHTPGPGAWTM
LDDARLKVGPLVTVTDLPDVPTLNPGALHATRDAVYVGTGSTPVALGQIQPPGKKMMNAA
DWARGVHLDQEASFE
Download sequence
Identical sequences Q8FT52
gi|25028275|ref|NP_738329.1| WP_006767719.1.13007 WP_006767719.1.3528 196164.CE1719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]