SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|25028308|ref|NP_738362.1| from Corynebacterium efficiens YS-314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|25028308|ref|NP_738362.1|
Domain Number 1 Region: 133-312,436-605
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.45e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 309-431
Classification Level Classification E-value
Superfamily GAD domain-like 3.27e-34
Family GAD domain 0.00073
Further Details:      
 
Domain Number 3 Region: 19-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.18e-30
Family Anticodon-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|25028308|ref|NP_738362.1|
Sequence length 617
Comment aspartyl-tRNA synthetase [Corynebacterium efficiens YS-314]
Sequence
MPRNHRQDISEWKDLLHVLRTHLSGELRKENAGQSVTLTGWVARRRDHGGVIFIDLRDRS
GIAQVVFRNEDVAERAHALRSEFVLQVTGVVEKRPEGSENPNLASGDVEVSVTDFTVLNE
SAPLPFQIEDASSAGEVGEETRLKYRYLDLRRPVQANALRLRSAANKAARTVLDSHDFTE
IETPTLTRSTPEGARDFLVPARLKPGTFYALPQSPQLFKQLLQVAGMERYYQIARCYRDE
DFRADRQPEFTQLDVEMSFVDQEDVIALAEEILTEVWKLIGYEISTPIPRITYADAMRLY
GSDKPDLRFDIQITECTDFFADTTFRVFKNEYVGAVVMKGGASQPRRQLDAWQEWAKQRG
AKGLAYILVGEDGELGGPVAKNITDAEREGIAAHVGAEPGDCIFFAAGDTRSSRALLGAA
RDEIARKLDLIRDGEWSFVWVVDAPMFESAADATASGDVALGNSKWTAVHHAFTSPKPEF
LDTFDENPGEALAYAYDIVCNGNEIGGGSIRIHQRDVQERVFKVMGISEEEARDKFGFLL
DAFAFGAPPHGGIAFGWDRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPAPITPLQRKE
SGIDAKPKAAENKPEEK
Download sequence
Identical sequences WP_006767752.1.13007 WP_006767752.1.3528 gi|25028308|ref|NP_738362.1| 196164.CE1752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]