SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15836042|ref|NP_300566.1| from Chlamydophila pneumoniae J138

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15836042|ref|NP_300566.1|
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15836042|ref|NP_300566.1|
Sequence length 116
Comment sigma regulatory factor [Chlamydophila pneumoniae J138]
Sequence
MSDIQKEEHGSTTIFHLHGKLDGISSPEVQENISQSLAAGSKNIILDCAHLDYMSSAGIR
VLLQSYHQVGQHSGKIVLTTVPKTIEQTLYVTGFLSYFKIFNTVDEAIQTLNKDGD
Download sequence
Identical sequences Q9Z841
gi|15618422|ref|NP_224707.1| gi|16752532|ref|NP_444794.1| NP_224707.1.662 WP_010883149.1.15326 WP_010883149.1.24544 WP_010883149.1.35099 WP_010883149.1.46341 WP_010883149.1.48548 WP_010883149.1.81029 WP_010883149.1.8178 WP_010883149.1.91433 WP_010883149.1.95540 115711.CP0243 115713.CPn0511 138677.CPj0511 182082.CpB0532 gi|15836042|ref|NP_300566.1| gi|33241863|ref|NP_876804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]