SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16752675|ref|NP_444942.1| from Chlamydophila pneumoniae AR39

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16752675|ref|NP_444942.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.7e-18
Family 2Fe-2S ferredoxin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16752675|ref|NP_444942.1|
Sequence length 91
Comment ferredoxin [Chlamydophila pneumoniae AR39]
Sequence
MAKLVITSDDEQQEFELEDNSEIAEPCESMGIPFACTEGVCGTCVIEVLEGRENLSEFTE
PEYDFLGEPEDSNERLACQCRIKGGCVKVTF
Download sequence
Identical sequences Q9Z8H9
gi|384449377|ref|YP_005661979.1| gi|15835897|ref|NP_300421.1| 115711.CP0393 115713.CPn0364 138677.CPj0364 182082.CpB0374 gi|15618279|ref|NP_224564.1| gi|33241707|ref|NP_876648.1| gi|16752675|ref|NP_444942.1| NP_224564.1.662 WP_010883007.1.100378 WP_010883007.1.15326 WP_010883007.1.24544 WP_010883007.1.35099 WP_010883007.1.46341 WP_010883007.1.48548 WP_010883007.1.81029 WP_010883007.1.8178 WP_010883007.1.91433 WP_010883007.1.95540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]