SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109150011|ref|NP_001035870.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109150011|ref|NP_001035870.1|
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily YlxR-like 1.7e-19
Family YlxR-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|109150011|ref|NP_001035870.1|
Sequence length 84
Comment hypothetical protein slr0743a [Synechocystis sp. PCC 6803]
Sequence
MAPGYRRCLSCRKVGDRRQFWRIVRVYPSRTVQLDHGAGRSAYLCPTHDCLRKARHKNLL
GRALRAPVPSHLFEQLEARLLTTP
Download sequence
Identical sequences L8ACQ0
gi|109150011|ref|NP_001035870.1| gi|383490082|ref|YP_005407758.1| 1148.slr0743a WP_010871325.1.11876 WP_010871325.1.1889 WP_010871325.1.18904 WP_010871325.1.33690 WP_010871325.1.35395 WP_010871325.1.47586 WP_010871325.1.99424 gi|109150011|ref|NP_001035870.1| gi|383321028|ref|YP_005381881.1| gi|383324198|ref|YP_005385051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]