SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161344753|ref|NP_442333.2| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161344753|ref|NP_442333.2|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.71e-106
Family BC ATP-binding domain-like 0.0000000101
Further Details:      
 
Domain Number 2 Region: 681-942
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.15e-103
Family BC ATP-binding domain-like 0.000000209
Further Details:      
 
Domain Number 3 Region: 396-550
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 9.02e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000793
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.59e-49
Family BC N-terminal domain-like 0.00000206
Further Details:      
 
Domain Number 5 Region: 557-683
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.44e-46
Family BC N-terminal domain-like 0.00000322
Further Details:      
 
Domain Number 6 Region: 945-1080
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.32e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161344753|ref|NP_442333.2|
Sequence length 1081
Comment carbamoyl phosphate synthase large subunit [Synechocystis sp. PCC 6803]
Sequence
MPRRNDLNKIMILGAGPIVIGQACEFDYSGTQACKALKEEGYEVVLVNSNPASIMTDPEL
ADRTYIEPLIPEIVEKIIEKERPDAVLPTMGGQTALNLAVSLSKSGVLEKYGVELIGAKL
PAIEMGEDRELFKEAMARIGVPVCPSGIASSIEEARQVAHEIGSYPLIIRPAFTLAGTGG
GIAYNQEEYEEMVQYGLDQSPMSQILVEKSLLGWKEYELEVMRDLADNVVIICSIENFDP
MGVHTGDSITVAPAQTLTDKEYQRLRDYSIAIIREIGVETGGSNIQFSVNPANGDVIVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYTLNEISNDITKKTPASFEPTIDYVVTKIP
RFAFEKFPGAEPILNTQMKSVGEAMAIGRTFQESFQKALRSLETGRFGFGCDRHETLPTL
SHLRSQLRTPNPERVFSLHHAFNLGMTVEEIHELTAIDPWFLDKLEDLVKTEKYMKQRSL
KDLTAADLRYIKQQGFGDRQIAFATKTTEDEVRAYRKSLGITPVYKVVDTCAAEFEAFTP
YYYSTYEPEECEVLPSDKPKVMILGGGPNRIGQGIEFDYCCCHAAFSLSDAGYETIMVNS
NPETVSTDYDTSDRLYFEPLTKEDVLNIIEAENPVGIIIQFGGQTPLKLAVPLQKYLNSP
DCPVQTKIWGTSPDSIDTAEDRERFEKILHELEISQPPNGIARDYEESRVVANRISYPVV
VRPSYVLGGRAMEIVYSDEELERYMTYAVQIEPDHPILIDKFLENAIEVDVDSLTDSTGK
VVIGSIMEHIEEAGIHSGDSACSIPYTSLSDNVLTTIRQWTEQLARALNVVGLMNIQYAV
QGDQVYILEANPRASRTVPYVSKATGRPLAKIASLVMSGKTLEELGVTEEFIPQHVAVKE
AVLPFSKFPGADTLLGPEMRSTGEVMGIDSDFGKAFAKAELGAGVILATTGTVFVSMSDR
TKEAAVPVVRELIDLGFKVVATSGTQKVLREHGIEGVEVVLKLHEGRPHVIDWIKNGQIQ
FIINTPSGEESQLDGRTIRRAALDYKLPIITTIAGGKATVAALRSLQDHPLDVKALQDYL
G
Download sequence
Identical sequences Q55756
gi|161344753|ref|NP_442333.2| gi|383492400|ref|YP_005410077.1| 1148.sll0370 gi|383326516|ref|YP_005387370.1| WP_010873630.1.11876 WP_010873630.1.1889 WP_010873630.1.18904 WP_010873630.1.33690 WP_010873630.1.35395 WP_010873630.1.47586 WP_010873630.1.99424 gi|161344753|ref|NP_442333.2| gi|383323347|ref|YP_005384201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]