SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161344758|ref|NP_441493.2| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161344758|ref|NP_441493.2|
Domain Number 1 Region: 61-150
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.44e-20
Family Ribosomal protein L9 C-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 5-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000162
Family Ribosomal protein L9 N-domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161344758|ref|NP_441493.2|
Sequence length 152
Comment 50S ribosomal protein L9 [Synechocystis sp. PCC 6803]
Sequence
MAKRVKVVLNETINKLGFTGDLVEVAPGYARNYLIPKGLGVVATPGILRQVEQRRLKELE
RLKAEKDAAEARKVALETIGRFVIKKQVGEAEAIFGTVTTQEVADAVEAATNQSLDRRGI
SLPDIHKTGFYQAQIKLHPEVIATVEVQVAPL
Download sequence
Identical sequences P42352
gi|161344758|ref|NP_441493.2| gi|383322507|ref|YP_005383360.1| WP_010872796.1.11876 WP_010872796.1.1889 WP_010872796.1.18904 WP_010872796.1.33690 WP_010872796.1.35395 WP_010872796.1.47586 WP_010872796.1.99424 1148.sll1244 gi|383325676|ref|YP_005386529.1| gi|161344758|ref|NP_441493.2| gi|383491560|ref|YP_005409236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]