SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161344765|ref|NP_441016.2| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161344765|ref|NP_441016.2|
Domain Number 1 Region: 171-307
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.31e-44
Family ATP-dependent riboflavin kinase-like 0.00048
Further Details:      
 
Domain Number 2 Region: 13-173
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.04e-31
Family Adenylyltransferase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161344765|ref|NP_441016.2|
Sequence length 313
Comment bifunctional riboflavin kinase/FMN adenylyltransferase [Synechocystis sp. PCC 6803]
Sequence
MRILSTTNVLQTPTAIALGNFDGVHRGHGVVLRQVMDFAQAVEHLLHPAVVSFNPHPRSF
FSGRTQPLLTPLPEKAAQLTAIGIEQLVLLPFTEKLANLSPKQFVQSILVEQLQAKFISV
GQDFCFGHQRRGNVQDLQNLGQEFGITVAIAQLEQTDTERISSSRIRRALKEGKLAMANH
LLGRPYALRGTVVQGQQLGRKLGFPTANLCLPADKLWPKYGVYAGWVNLNALDVPIPAVI
NLGDRPTVNGQEPSAEVHLLQWSGDLYGQGLEVALTHYLRPETKFAGLDQLKNQIAQDCQ
QAEKLLNLDGAIP
Download sequence
Identical sequences gi|161344765|ref|NP_441016.2| gi|383491082|ref|YP_005408758.1| gi|383322029|ref|YP_005382882.1| WP_010872326.1.11876 WP_010872326.1.1889 WP_010872326.1.18904 WP_010872326.1.33690 WP_010872326.1.35395 WP_010872326.1.47586 WP_010872326.1.99424 gi|161344765|ref|NP_441016.2| 1148.slr1882 gi|383325198|ref|YP_005386051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]