SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329179|ref|NP_439907.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329179|ref|NP_439907.1|
Domain Number 1 Region: 85-373
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.64e-60
Family Alanine racemase-like, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 481-589
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000837
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329179|ref|NP_439907.1|
Sequence length 659
Comment arginine decarboxylase [Synechocystis sp. PCC 6803]
Sequence
MGEEPVPADKALGKKFKKKNASWSIEESEALYRVEAWGAPYFAINAAGNITVSPNGDRGG
SLDLLELVEALRQRKLGLPLLIRFSDILADRLERLNSCFAKAIARYNYPNTYQAVYPVKC
NQQRHLVEALVRFGQTSQCGLEAGSKPELMIALATLPPPLDRQDKHTKPLIICNGYKDQD
YLETALLAKRLGHRPIIIIEQLRELEWVLHISQQLNIKPMLGVRARLSCQSLKSSEISSG
NGDRAKLGLTMPDIVTVIHRLEENNCLDCLKMLHFHLGTQVSDIALIKEAMREASQLYVE
LVKLGAKMRYLNVGGGLAVDYDGSKTNYPASKNYNMQNYANDIVAAIQDACELGQVSPPI
LVSESGRAIMAHQSVLVFDVLGSNQTGFSEPHPPDENAHPLLKNLWECYETITAEQYQEQ
YHDALQLKTEASSLFNFGYLSLTERGQAEQIHWACCRKIFEITRQLEYIPEDFQALDKIM
TDIYYVNLSVFQSAPESWSLDQLFPILPIHHLNEKPSQRVILADLTCDSDGKIDRFIDLW
DVKSYLEVHPLENDGNPYYLGMFLVGAYQEIMGNLHNLFGDINVVHIATTPQGYQIESVV
RGDTMTEVLGYVQYDSDDLLEGLRRHTELALSNGQITLEESRRLLEDYEQSLRRYTYLS
Download sequence
Identical sequences L8AE63 P72587
gi|383489972|ref|YP_005407648.1| gi|16329179|ref|NP_439907.1| 1148.slr1312 gi|383320918|ref|YP_005381771.1| gi|16329179|ref|NP_439907.1| NYSGRC-FDAO-BAA16587 SgR9 WP_010871215.1.11876 WP_010871215.1.1889 WP_010871215.1.18904 WP_010871215.1.33690 WP_010871215.1.35395 WP_010871215.1.47586 WP_010871215.1.99424 gi|383324088|ref|YP_005384941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]