SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329290|ref|NP_440018.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329290|ref|NP_440018.1|
Domain Number 1 Region: 148-587
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.93e-126
Family Amylase, catalytic domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 17-156
Classification Level Classification E-value
Superfamily E set domains 4.48e-43
Family E-set domains of sugar-utilizing enzymes 0.0046
Further Details:      
 
Domain Number 3 Region: 649-746
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.44e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329290|ref|NP_440018.1|
Sequence length 746
Comment glycogen operon protein GlgX [Synechocystis sp. PCC 6803]
Sequence
MPQLISVPNLSTDVHLGQTFPLGATVYADGVNFCLFSKHAERVTLLLFDRPNDPAPARTI
ELHRGRNRTFYYWHVFVKGLKAGQVYAYRVDGPHEPEKGHRFDPDKVLLDPYAKAIVGKD
IYDRKAAMALGDNCAQALRSVVVDTSVYDWEDDHAPRTPYAASIIYELHVGGFTRNPNSG
LSENKRGTYAGLIEKIPYLKELGITAVELLPVHYFDPEDAQPGLTNYWGYSTIGFFAPHQ
GYSAADDPLEVVDEFRDMVKALHKAGIEVILDVVFNHTAEGNEKGPTLSFRGIDNRTYYI
LDEDKSSYSNYSGCGNSVKANHPVVGGLILDSLRYWVSEMHVDGFRFDLASVLVRDTKGV
PLHGSEIATANIIWAIESDPILAGTKLIAEAWDAAGLYSVGKFVELADWFAEWNGPFRDD
VRRFVKGDNGAVPALASRLLGSPDIYYRQDTDINRSINFVTCHDGFTLVDLVSYNEKHNE
ANGEKNRDGTNDNFSWNCGVEGETDDPKINQLRLRQIKNFLTILFFSQGTPMLLMGDPVG
RTQQGNNNGYCQDNELSWFDWSGEETHSDETHFLRGIIALTQSLSLFLEESLLPVLNFAL
PRFPDENDGSEGDGQDGEEPVYKPLPPVDEAALREMYLKATKDLPGSCVVWHGVKLAQPD
WSYTSHTLAVTLFHPGAEEILHLIFNAYWEPLNFELPPLNDGLIWHRLVDTYLPTPLDFQ
EPAIASPVEGETYWVQPRSSVVLMAK
Download sequence
Identical sequences P72691
gi|383324201|ref|YP_005385054.1| gi|383490085|ref|YP_005407761.1| gi|16329290|ref|NP_440018.1| gi|16329290|ref|NP_440018.1| WP_010871328.1.11876 WP_010871328.1.1889 WP_010871328.1.18904 WP_010871328.1.33690 WP_010871328.1.35395 WP_010871328.1.47586 WP_010871328.1.99424 1148.slr0237 gi|383321031|ref|YP_005381884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]