SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329326|ref|NP_440054.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329326|ref|NP_440054.1|
Domain Number 1 Region: 3-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.09e-86
Family ATP synthase (F1-ATPase), gamma subunit 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329326|ref|NP_440054.1|
Sequence length 314
Comment ATP synthase F0F1 subunit gamma [Synechocystis sp. PCC 6803]
Sequence
MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVLSTRPFADALAQVLYNLQNRL
SFAETELPLFEQREPKAVALLVVTGDRGLCGGYNVNAIKRAEQRAKELKNQGIAVKLVLV
GSKAKQYFGRRDYDVAASYANLEQIPNASEAAQIADSLVALFVSETVDRVELIYTRFVSL
ISSQPVVQTLFPLSPQGLEAPDDEIFRLITRGGKFQVEREKVEAPVESFPQDMIFEQDPV
QILEALLPLYNTNQLLRALQESAASELAARMTAMSNASDNAGQLIGTLTLSYNKARQAAI
TQELLEVVAGANSL
Download sequence
Identical sequences L8AEQ3 P17253
gi|383321067|ref|YP_005381920.1| gi|16329326|ref|NP_440054.1| WP_010871364.1.11876 WP_010871364.1.1889 WP_010871364.1.18904 WP_010871364.1.33690 WP_010871364.1.35395 WP_010871364.1.47586 WP_010871364.1.99424 gi|383324237|ref|YP_005385090.1| gi|383490121|ref|YP_005407797.1| gi|16329326|ref|NP_440054.1| 1148.sll1327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]