SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329353|ref|NP_440081.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329353|ref|NP_440081.1|
Domain Number 1 Region: 605-852
Classification Level Classification E-value
Superfamily EAL domain-like 1.7e-70
Family EAL domain 0.0028
Further Details:      
 
Domain Number 2 Region: 435-592
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.67e-29
Family GGDEF domain 0.00092
Further Details:      
 
Domain Number 3 Region: 7-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.18e-28
Family FHA domain 0.0091
Further Details:      
 
Domain Number 4 Region: 290-412
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000244
Family N-terminal PAS domain of Pas kinase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329353|ref|NP_440081.1|
Sequence length 853
Comment hypothetical protein slr1102 [Synechocystis sp. PCC 6803]
Sequence
MPSMSNDSIVRHVLVIEDQKSRRIVSLEENTYDIGRDPSSAIPIYDRQVSRHHATLIRVN
DYQNHQYTYRLIDGNLQGKRSTNGVVVNGQYCLSHELEHGDVIRFGNQSKASYHIMNLTT
ESEEQPYGAEPVSVVANPIMGETYVDPLNFAMADHGYGEGAGFDHEAVEVEEDSSFSTAV
VYNDEIPDVSRSAPLPSHRPPASLSENSTQLIVELTTAGQVIYANGATKALFPELMAIQA
QHPLIQGLSNLSLTREGLQLERDIAIGQQIFHQRIFLGPDRSRLQCYSEDVTEYRKMEQG
LNDLHHRLQAYREYSATGFLLVDARTKTVVEANSAFCQLLGYEESEVLDFTLYQLIAAER
PVIEELLINLETQNYLSVPELEYRNREGQTVQVKGEVYRLPWEDREVYCFVMRTPRGRQG
YSETLANQALYDPISKLPNRVNLQKELSLAIDAAAHHQHLMGVMFIHLEILNRINQAYGF
GFGDEVFMAFHGAISDCMRSGDTVGQWDSNTLVIILAKIKSPQDSIRLAERILDRLKNPI
TVREREFIFNINIGISAYPNDGNRAEDLLSRANAALQKLRQTGFNHYQCYDPKFSTAALH
QARLENLLQQAIAKRQLTLQYQPQIHLQSGEITAIEALLRWEHPEVGEIAPGKIIPIAAR
SNLIFELSDWIFRTACQQNLEWQKDGSPPRAIAINLSAREFYRQDLVMMVGKTLEETGLD
PQWLELEITENTLRQQPAKALAILQDLKTFGVRIALDDFGLGQMGIGFVTQFPFTTIKIH
QGFMARLRGTPQEMAILQSIFALSQGFQYRLVAEGIETDAQLSLIKQLQCQEVQGFLLSR
PLRKREMGQFLQK
Download sequence
Identical sequences P72746
gi|16329353|ref|NP_440081.1| 1148.slr1102 gi|383321094|ref|YP_005381947.1| gi|16329353|ref|NP_440081.1| gi|383324264|ref|YP_005385117.1| WP_010871391.1.11876 WP_010871391.1.1889 WP_010871391.1.18904 WP_010871391.1.33690 WP_010871391.1.35395 WP_010871391.1.47586 WP_010871391.1.99424 gi|383490148|ref|YP_005407824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]