SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329363|ref|NP_440091.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329363|ref|NP_440091.1|
Domain Number 1 Region: 392-658
Classification Level Classification E-value
Superfamily PP2C-like 3.27e-49
Family PP2C-like 0.00015
Further Details:      
 
Weak hits

Sequence:  gi|16329363|ref|NP_440091.1|
Domain Number - Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.011
Family Ribosomal protein L40e 0.043
Further Details:      
 
Domain Number - Region: 180-262
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0918
Family Protein kinases, catalytic subunit 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329363|ref|NP_440091.1|
Sequence length 668
Comment Ser/Thr phosphatase [Synechocystis sp. PCC 6803]
Sequence
MLICLQCSAENPNRNTDCQKCGASLKEHPCNQCGEMVQYGEAHCPHCGAIAGQILTVLVT
VPVAVGPDGKPEQSFDPQGIRLYENFIDVGQRYQLLTPVEENPFVVDEVGEGEQIVLKSR
VVDCQPLQPSVLKVLLSQQGDLLTRLPQMSDGEIMANDTWSSLNLPKAIIPYFRFPVLMP
KIPEVYDAWCDGDYGFVLMEDRSEWDVLADVLRDEGDSLPGLEMVFWINQLFQLWQQLSS
AGCGKGLLMGQNLLVDEDQNIALEQIYANGGTPVSLEEFGSLLHGYFSPVPSAGEDLLAI
LQRAAQGEYQDVDDLFADIEDLVITVEEEGENFIIHEVDFEQIPDDVFAAIESGESAFKS
EEVAPSINPVTMPDVNVFDSEEVDDVPTAVLPMQLISLVDAGYTDRGGHRQHNEDFFGIT
TSVETHRNNHGKTIKAQGVYVVCDGMGGHAAGEVASQMGVKTLLEYFQIVMANRLPDKNT
ITEGINLANQKIYEVNQSNASSGSGRMGTTLVMMLVKDTTMAIAHVGDSRIYRVTRKNGL
EQLTVDHEVGQQAILNGLDPTLAYARPDAYQLTQALGPHSSSYLQPDVAIFEIEEDCLIL
LCSDGISDNDFVEEHWQELLLPYVSSSQDVDRGLRKLMEAANEYNGHDNLTGVLVRLKVR
PQIPLDVW
Download sequence
Identical sequences P72756
gi|16329363|ref|NP_440091.1| 1148.sll1033 gi|16329363|ref|NP_440091.1| gi|383324274|ref|YP_005385127.1| WP_010871401.1.11876 WP_010871401.1.1889 WP_010871401.1.18904 WP_010871401.1.33690 WP_010871401.1.35395 WP_010871401.1.47586 WP_010871401.1.99424 gi|383490158|ref|YP_005407834.1| gi|383321104|ref|YP_005381957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]