SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329397|ref|NP_440125.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329397|ref|NP_440125.1|
Domain Number 1 Region: 293-450
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.16e-50
Family GGDEF domain 0.00011
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily CheY-like 3.42e-39
Family CheY-related 0.0013
Further Details:      
 
Domain Number 3 Region: 139-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000019
Family Heme-binding PAS domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16329397|ref|NP_440125.1|
Sequence length 452
Comment regulatory components of sensory transduction system [Synechocystis sp. PCC 6803]
Sequence
MENTDEKKGNILLVDDLPNNLQLLSDLLINLGYTVRSVTSGKMALRTLQVKRPDLILLDI
KMPDMDGYQVCEMIKKEEELQDIPIIFISALGDTFDKVKAFECGGVDYITKPFQIEEVVA
RIEGQFTIQRQRIALKREVRKRREAEEVLYQSRALLSSVLNSALDGIAAMQAVRNPQTGD
IEDFRCLVINPILSKAFNRSREDLIGRVLLKRFLQRLDPQLFDQFVNLVETGTFLTQDIY
FPIANSDWYHFVAVKLGDGFAVTVRDITDRKRMELELQAANQQLQLLANIDGLTHIANRR
RFDEYLAQEWQRHCREQKPLSLILVDIDYFKAYNDLYGHQKGDDCLQKVANTLVDIAKRI
TDLVARYGGEEFVIVLPNTNRQDALAMAENMLQAIAALAIPHEGSSVSKYVTISIGVSSI
IPMPEDTIERIISEADQALYSAKSQGRNRAIA
Download sequence
Identical sequences L8AG96 P72790
gi|383321138|ref|YP_005381991.1| gi|383490192|ref|YP_005407868.1| gi|16329397|ref|NP_440125.1| gi|383324308|ref|YP_005385161.1| 1148.sll1673 gi|16329397|ref|NP_440125.1| WP_010871435.1.11876 WP_010871435.1.1889 WP_010871435.1.18904 WP_010871435.1.33690 WP_010871435.1.35395 WP_010871435.1.47586 WP_010871435.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]